General Information

  • ID:  hor000678
  • Uniprot ID:  Q862B1
  • Protein name:  Calcitonin receptor-stimulating peptide 1
  • Gene name:  CRSP1
  • Organism:  Sus scrofa (Pig)
  • Family:  Calcitonin family
  • Source:  Animal
  • Expression:  Mainly expressed in the thyroid gland and CNS. Found in the nerve cells of cerebrum, hippocampus, hypothalamus, pons/midbrain and thalamus.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Sus (genus), Suidae (family), Suina (suborder), Artiodactyla (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0031716 calcitonin receptor binding
  • GO BP:  GO:0007165 signal transduction; GO:0007189 adenylate cyclase-activating G protein-coupled receptor signaling pathway; GO:0051480 regulation of cytosolic calcium ion concentration
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  SCNTATCMTHRLVGLLSRSGSMVRSNLLPTKMGFKVFG
  • Length:  38(81-118)
  • Propeptide:  MGFWKFPPFLVLSILVLYQAGMFHTAPMRSAFGSPFDPATLSEEESRLLLAAMVNDYEQMKAREMQKQRAQGSGISVQKRSCNTATCMTHRLVGLLSRSGSMVRSNLLPTKMGFKVFGGRRRNFWI
  • Signal peptide:  MGFWKFPPFLVLSILVLYQAGMFHT
  • Modification:  T38 Glycine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Stimulates cAMP production in porcine kidney cell line LLC-PK1 via the calcitonin receptor (CT) but not via the CT-like (CL) receptor.
  • Mechanism:  Stimulates cAMP production in porcine kidney cell line LLC-PK1 via the calcitonin receptor (CT) but not via the CT-like (CL) receptor.
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  45695
  • Structure ID:  AF-Q862B1-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor000678_AF2.pdbhor000678_ESM.pdb

Physical Information

Mass: 476202 Formula: C175H295N53O50S5
Absent amino acids: DEIQWY Common amino acids: LS
pI: 11.55 Basic residues: 6
Polar residues: 17 Hydrophobic residues: 11
Hydrophobicity: 21.58 Boman Index: -4322
Half-Life: 1.9 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 76.84
Instability Index: 5732.11 Extinction Coefficient cystines: 125
Absorbance 280nm: 3.38

Literature

  • PubMed ID:  12556539
  • Title:  Calcitonin Receptor-Stimulating Peptide, a New Member of the Calcitonin Gene-Related Peptide Family. Its Isolation From Porcine Brain, Structure, Tissue Distribution, and Biological Activity.
  • PubMed ID:  18544925
  • Title:  Genomic organization, expression and evolution of porcine CRSP